01 Beginner Cybersecurity Path
Welcome to the Beginner Cybersecurity Path.
This is the starting point for your hands-on cybersecurity practice.
Before specializing in SOC operations, ethical hacking, web security, Active Directory, or cloud security, you need to become comfortable working with the technologies that cybersecurity professionals interact with every day.
The objective is not to complete as many TryHackMe rooms as possible.
Your objective is to build a strong technical foundation.
Learn the technology first. Security becomes much easier when you understand what you are protecting or assessing.
Path Objective
Section titled “Path Objective”By completing this practice path, you should develop foundational skills across:
- computer networking
- TCP/IP
- Linux
- Windows
- command-line environments
- web technologies
- cybersecurity fundamentals
- defensive security
- offensive security concepts
- security tools
- basic investigation
- cybersecurity documentation
This path prepares you for the specialized practice paths that follow.
Recommended Learning Journey
Section titled “Recommended Learning Journey”Follow this sequence:
Cybersecurity Fundamentals ↓Networking Fundamentals ↓Linux Fundamentals ↓Windows Fundamentals ↓Web Fundamentals ↓Security Tools ↓Defensive Security ↓Offensive Security Fundamentals ↓Beginner Challenges ↓Choose Your SpecializationDo not rush through these stages.
Each stage provides knowledge required later.
Stage 01 — Cybersecurity Fundamentals
Section titled “Stage 01 — Cybersecurity Fundamentals”Start by understanding what cybersecurity actually protects.
You should understand the relationship between:
Assets → Threats → Vulnerabilities → Risk → Controls
Topics to Practice
Section titled “Topics to Practice”Focus on:
-
cybersecurity fundamentals
-
confidentiality, integrity and availability
-
threats
-
vulnerabilities
-
security controls
-
authentication
-
authorization
-
encryption basics
-
malware
-
phishing
-
social engineering
-
security monitoring
-
incident response
-
penetration testing
You Should Be Able to Explain
Section titled “You Should Be Able to Explain”Before moving forward, answer:
What is a vulnerability?
A weakness that could potentially be exploited.
What is a threat?
Something capable of causing harm to a system or organization.
What is risk?
The potential impact associated with threats exploiting vulnerabilities.
What is a security control?
A safeguard designed to reduce security risk.
These concepts will appear throughout your cybersecurity career.
Stage 02 — Networking Fundamentals
Section titled “Stage 02 — Networking Fundamentals”Networking is one of the most important foundations in cybersecurity.
Attackers, defenders, SOC analysts, penetration testers and cloud security engineers all need networking knowledge.
Topics to Practice
Section titled “Topics to Practice”Focus on:
-
IP addresses
-
MAC addresses
-
TCP
-
UDP
-
ports
-
protocols
-
DNS
-
DHCP
-
HTTP
-
HTTPS
-
SSH
-
network routing
-
firewalls
-
packets
-
client-server communication
Understand Common Ports
Section titled “Understand Common Ports”You should gradually become familiar with common services.
| Port | Protocol/Service |
|---|---|
| 22 | SSH |
| 25 | SMTP |
| 53 | DNS |
| 80 | HTTP |
| 110 | POP3 |
| 143 | IMAP |
| 443 | HTTPS |
| 445 | SMB |
| 3389 | RDP |
Do not memorize the entire port range.
Learn the services you encounter frequently.
Practice Goal
Section titled “Practice Goal”You should understand what happens when:
User ↓Browser ↓DNS ↓IP Address ↓TCP Connection ↓Web Server ↓HTTP/HTTPS ResponseThis understanding becomes extremely important when investigating attacks.
Stage 03 — Linux Fundamentals
Section titled “Stage 03 — Linux Fundamentals”Linux is everywhere in cybersecurity.
You will encounter Linux in:
-
servers
-
cloud environments
-
containers
-
security appliances
-
penetration-testing environments
-
DevOps platforms
-
Kubernetes
-
cybersecurity tools
Skills to Practice
Section titled “Skills to Practice”Become comfortable with:
pwdlscdmkdircpmvrmcatlessheadtailgrepfindwhoamiidpsYou should also understand:
-
files and directories
-
users
-
groups
-
permissions
-
processes
-
services
-
logs
-
environment variables
-
package management
-
basic shell usage
Permissions
Section titled “Permissions”Understand permissions such as:
r = Readw = Writex = ExecuteAnd how they apply to:
UserGroupOthersPractice Goal
Section titled “Practice Goal”By the end of this stage, you should be comfortable navigating a Linux system without depending entirely on a graphical interface.
Stage 04 — Windows Fundamentals
Section titled “Stage 04 — Windows Fundamentals”Enterprise environments rely heavily on Windows.
SOC analysts, incident responders and penetration testers frequently investigate Windows systems.
Topics to Practice
Section titled “Topics to Practice”Learn:
-
Windows filesystem
-
users
-
groups
-
services
-
processes
-
permissions
-
Task Manager
-
Event Viewer
-
Windows Registry
-
command prompt
-
PowerShell fundamentals
-
Windows Defender
-
Windows Firewall
Important Security Concepts
Section titled “Important Security Concepts”Understand the purpose of:
UsersGroupsLocal AdministratorServicesProcessesRegistryEvent LogsSecurity PoliciesLater, these concepts become essential when studying Active Directory.
Stage 05 — Web Fundamentals
Section titled “Stage 05 — Web Fundamentals”A large percentage of modern applications are web-based.
Understanding how web applications work is therefore essential.
Topics to Practice
Section titled “Topics to Practice”Learn:
-
HTTP
-
HTTPS
-
URLs
-
domains
-
DNS
-
requests
-
responses
-
headers
-
cookies
-
sessions
-
authentication
-
APIs
-
HTML
-
JavaScript fundamentals
-
databases
Understand the Request Flow
Section titled “Understand the Request Flow”Browser ↓HTTP Request ↓Web Server ↓Application ↓Database ↓HTTP Response ↓BrowserSecurity vulnerabilities can appear at almost every layer.
Stage 06 — Security Tools Fundamentals
Section titled “Stage 06 — Security Tools Fundamentals”Now begin becoming familiar with common cybersecurity tools.
The objective is not to memorize commands.
Understand what problem each tool solves.
Network Analysis
Section titled “Network Analysis”Become familiar with tools used for:
-
connectivity testing
-
DNS investigation
-
packet analysis
-
service identification
-
network troubleshooting
Examples may include:
pingtraceroutenslookupdigWiresharkSecurity Assessment
Section titled “Security Assessment”Inside authorized lab environments, become familiar with tools used for:
-
host discovery
-
service identification
-
vulnerability investigation
-
web analysis
The important question is always:
Why am I using this tool?
Do not become dependent on automated tools without understanding the underlying technology.
Stage 07 — Defensive Security Fundamentals
Section titled “Stage 07 — Defensive Security Fundamentals”Cybersecurity is not only about finding vulnerabilities.
You also need to understand how organizations detect attacks.
Topics to Practice
Section titled “Topics to Practice”Explore:
-
SOC operations
-
security monitoring
-
log analysis
-
alerts
-
SIEM concepts
-
endpoint security
-
network monitoring
-
incident response
-
threat intelligence
Think Like an Analyst
Section titled “Think Like an Analyst”When examining an event, ask:
What happened?
Who performed the activity?
Which system was involved?
When did it happen?
Was the activity expected?
What evidence exists?
What should happen next?This mindset prepares you for the SOC Analyst Practice Path.
Stage 08 — Offensive Security Fundamentals
Section titled “Stage 08 — Offensive Security Fundamentals”Next, understand the basic methodology used during authorized security assessments.
Practice only in environments specifically designed or authorized for security testing.
Learn the Methodology
Section titled “Learn the Methodology”A simplified workflow is:
Scope ↓Reconnaissance ↓Enumeration ↓Vulnerability Analysis ↓Controlled Validation ↓Evidence Collection ↓Remediation ↓ReportingAt this stage, concentrate on understanding the methodology rather than trying to master exploitation.
Key Principle
Section titled “Key Principle”A cybersecurity professional should always understand:
Scope
What systems may be tested?
Authorization
Who has approved the testing?
Impact
Could testing affect availability or data?
Evidence
How will findings be documented?
Remediation
How should the weakness be corrected?
Stage 09 — Beginner Challenges
Section titled “Stage 09 — Beginner Challenges”After completing the fundamentals, begin solving small challenges without step-by-step guidance.
Challenges might combine:
-
Linux
-
networking
-
Windows
-
web technologies
-
logs
-
security concepts
The goal is to test whether you can connect multiple skills.
How to Practice Each TryHackMe Room
Section titled “How to Practice Each TryHackMe Room”Use the same workflow for every practice activity.
1. Read
Section titled “1. Read”Understand the scenario before starting.
2. Identify the Technology
Section titled “2. Identify the Technology”Ask yourself:
Linux?Windows?Network?Web?Identity?Cloud?Logs?3. Identify the Objective
Section titled “3. Identify the Objective”Determine what skill the exercise is teaching.
4. Attempt Independently
Section titled “4. Attempt Independently”Try solving the problem before looking for walkthroughs.
5. Research
Section titled “5. Research”When stuck, research the concept rather than immediately searching for the answer.
6. Complete
Section titled “6. Complete”Finish the activity while understanding why the solution works.
7. Document
Section titled “7. Document”Write down what you learned.
Beginner Practice Notes
Section titled “Beginner Practice Notes”For each meaningful room, create a small practice record.
Use this template:
Room:
Category:
Difficulty:
Technology:
Objective:
What I Learned:
Important Commands/Tools:
Security Concepts:
Mistakes I Made:
How Would a Defender Detect This?
How Would the Organization Mitigate It?
Completed:This is much more valuable than simply recording:
Room completed.
Beginner Skills Checklist
Section titled “Beginner Skills Checklist”Before leaving the Beginner Cybersecurity Path, evaluate yourself.
Networking
Section titled “Networking”-
I understand IP addresses
-
I understand TCP and UDP
-
I understand ports
-
I understand DNS
-
I understand HTTP/HTTPS
-
I understand basic network traffic
-
I can navigate Linux
-
I can work with files
-
I understand users and groups
-
I understand permissions
-
I can inspect processes
-
I can locate basic logs
Windows
Section titled “Windows”-
I understand Windows users
-
I understand groups
-
I understand processes
-
I understand services
-
I know the purpose of Event Viewer
-
I understand basic PowerShell usage
-
I understand HTTP requests
-
I understand HTTP responses
-
I understand headers
-
I understand cookies
-
I understand sessions
-
I understand basic authentication
Security
Section titled “Security”-
I understand threats
-
I understand vulnerabilities
-
I understand risk
-
I understand security controls
-
I understand basic SOC operations
-
I understand basic ethical hacking methodology
When Are You Ready to Move Forward?
Section titled “When Are You Ready to Move Forward?”Do not wait until you know everything.
You are ready when you can comfortably explain the fundamentals and perform basic tasks without following every instruction word-for-word.
Your goal should move from:
I watched it. ↓I followed it. ↓I understand it. ↓I can do it. ↓I can explain it.That final stage is where real skill begins developing.
Choose Your Next Practice Path
Section titled “Choose Your Next Practice Path”After completing the Beginner Cybersecurity Path, you do not necessarily need to complete every specialization immediately.
Choose according to your career direction.
SOC / Blue Team
Section titled “SOC / Blue Team”➡️ 02 SOC Analyst Practice
Continue into:
-
security monitoring
-
SIEM
-
log analysis
-
alert investigation
-
endpoint investigation
-
incident response
Ethical Hacking / Penetration Testing
Section titled “Ethical Hacking / Penetration Testing”➡️ 03 Ethical Hacking Practice
Continue into:
-
reconnaissance
-
enumeration
-
vulnerability assessment
-
controlled exploitation
-
privilege escalation
-
reporting
Application Security / Web Pentesting
Section titled “Application Security / Web Pentesting”➡️ 04 Web Security Practice
Continue into:
-
HTTP analysis
-
authentication security
-
access control
-
OWASP vulnerabilities
-
web application testing
Active Directory Security
Section titled “Active Directory Security”➡️ 05 Active Directory Practice
Continue into:
-
Windows domains
-
Active Directory
-
Kerberos
-
enterprise identity
-
authentication
-
AD security
Cloud Security
Section titled “Cloud Security”➡️ 06 Cloud Security Practice
Continue into:
-
cloud IAM
-
cloud networking
-
misconfigurations
-
logging
-
monitoring
-
cloud attack paths
-
incident investigation
What’s Next?
Section titled “What’s Next?”➡️ 02 SOC Analyst Practice
Next, we will build a structured TryHackMe practice path for students targeting SOC Analyst, Security Analyst, Blue Team and Incident Response roles.
The focus changes from general cybersecurity fundamentals to investigating real security activity:
Alert → Evidence → Investigation → Decision → Escalation → Response → Documentation
The objective will not be simply completing SOC rooms.
You will begin learning to work and think like a SOC analyst.
This keeps `01 Beginner Cybersecurity Path` broad enough for **everyone** before the student branches into the role-specific practice sections shown in your Academy navigation.